For every approved affiliate after their first sale.
One Aminos affiliate outreach
Turn conversations into lifetime income.
Send thoughtful DMs every day, bring qualified creators into the One Aminos partner program, and earn on every approved relationship you build.
01 · How you get paid
Four ways to earn.
Of every dollar your recruited affiliates generate.
For 7 approved affiliates in one Tuesday–Tuesday cycle.
For the recruiter with the most approved affiliates.
Ishaan pulled 7 affiliates in a week.
Here is what each affiliate sold and exactly how Ishaan’s pay is calculated.
Affiliate 1Affiliate sales$200Your $10 reward$10Your 5% share$10.00
Affiliate 2Affiliate sales$100Your $10 reward$10Your 5% share$5.00
Affiliate 3Affiliate sales$50Your $10 reward$10Your 5% share$2.50
Affiliate 4Affiliate sales$0Your $10 reward$0Your 5% share$0.00
Affiliate 5Affiliate sales$150Your $10 reward$10Your 5% share$7.50
Affiliate 6Affiliate sales$100Your $10 reward$10Your 5% share$5.00
Affiliate 7Affiliate sales$125Your $10 reward$10Your 5% share$6.25
TotalsAffiliate sales$725First-sale rewards$60.005% revenue share$36.25
How Ishaan gets paid
Four earnings add up to the weekly total.
6 affiliates got a sale · 6 × $10$60.00
5% of all affiliate revenue · $725 × 5%$36.25
Bonus for pulling 7 affiliates in one week$25.00
Bonus for highest affiliate count that week$25.00
Ishaan earned this week$146.25
03 · What to do
Search. DM. Reply.
Start with TikTok and Instagram. Find relevant creators, send the opening DM, and use the replies below.
DM outreachTikTokInstagram
What to search
glpglp1peptidebest peptidesghkcu for acneghk-cubpascendtirzlabsourcedghostlabzbiohackingglowuppepspeptidesciencegymfitnessweightlossmt2gymtokretasemaretatrutidesemaglutidebpc157tb500cjc1295ipamorelinmots-ctesamorelinaod9604nad+peptide stackresearch peptidesrecoverytokbodybuildingcuttingskincaretokhair growthlongevity
What to DM
Hey! I love your content. I have a paid partnership opportunity for you!
When they reply
Hey, I’m a manager at oneaminos.com. We sell premium research peptides that are 7x tested. We offer 25–35% commission, 15% off for your audience, and $150 store credit after 3 qualifying sales with your link or code. Let me know if you’re interested—I’d love to share more details!
If they are interested
Awesome! Text 443-852-0470 to get signed up, then create your One Aminos rewards account here: oneaminos.com/rewards
If they already have a deal
Totally understand. What are they currently offering you? Send me the details and I’ll see if One Aminos can beat it.
When they want details
Send them the One Aminos partner graphic.
Download offer graphic
If they have a particular question
Take a screenshot and text Ishaan. He will tell you exactly how to reply.
Text IshaanLive cycle
Recruiter leaderboard
Tuesday – Tuesday. Only approved affiliates count toward the race.
No recruiters yet.
Add yourself to open the first private recruiter page.